POU6F2 (NM_007252) Human Mass Spec Standard

SKU
PH324192
POU6F2 MS Standard C13 and N15-labeled recombinant protein (NP_009183)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224192]
Predicted MW 73.3 kDa
Protein Sequence
Protein Sequence
>RC224192 representing NM_007252
Red=Cloning site Green=Tags(s)

MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPA
LSDPGTPDQHQASQTHPPFPVGPQPLLTAQQLASAVAGVMPGGPPALNQPILIPFNMAGQLGGQQGLVLT
LPTANLTNIQGLVAAAAAGGIMTLPLQNLQATSSLNSQLQQLQLQLQQQQQQQQQQPPPSTNQHPQPAPQ
APSQSQQQPLQPTPPQQPPPASQQPPAPTSQLQQAPQPQQHQPHSHSQNQNQPSPTQQSSSPPQKPSQSP
GHGLPSPLTPPNPLQLVNNPLASQAAAAAAAMSSIASSQAFGNALSSLQGVTGQLVTNAQGQIIGTIPLM
PNPGPSSQAASGTQGLQVQPITPQLLTNAQGQIIATVIGNQILPVINTQGITLSPIKPGQQLHQPSQTSV
GQAASQGNLLHLAHSQASMSQSPVRQASSSSSSSSSSSALSVGQLVSNPQTAAGEVDGVNLEEIREFAKA
FKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPAR
FEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNT
HPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPATAVPLEPLTDSLEENS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009183
RefSeq Size 2324
RefSeq ORF 2073
Synonyms RPF-1; WT5; WTSL
Locus ID 11281
UniProt ID P78424
Cytogenetics 7p14.1
Summary This gene encodes a member of the POU protein family characterized by the presence of a bipartite DNA binding domain, consisting of a POU-specific domain and a homeodomain, separated by a variable polylinker. The DNA binding domain may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner. The POU family members are transcriptional regulators, many of which are known to control cell type-specific differentiation pathways. This gene is a tumor suppressor involved in Wilms tumor (WT) predisposition. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:POU6F2 (NM_007252) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416091 POU6F2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431549 POU6F2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416091 Transient overexpression lysate of POU class 6 homeobox 2 (POU6F2), transcript variant 1 100 ug
$665.00
LY431549 Transient overexpression lysate of POU class 6 homeobox 2 (POU6F2), transcript variant 2 100 ug
$436.00
TP324192 Recombinant protein of human POU class 6 homeobox 2 (POU6F2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328521 Purified recombinant protein of Homo sapiens POU class 6 homeobox 2 (POU6F2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.