Alkaline Phosphatase (ALPI) (NM_001631) Human Mass Spec Standard

SKU
PH324178
ALPI MS Standard C13 and N15-labeled recombinant protein (NP_001622)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224178]
Predicted MW 56.81 kDa
Protein Sequence
Protein Sequence
>RC224178 representing NM_001631
Red=Cloning site Green=Tags(s)

MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA
TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC
NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI
SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS
VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA
VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY
TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001622
RefSeq Size 2516
RefSeq ORF 1584
Synonyms IAP
Locus ID 248
UniProt ID P09923
Cytogenetics 2q37.1
Summary There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014]
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:Alkaline Phosphatase (ALPI) (NM_001631) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400612 ALPI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400612 Transient overexpression lysate of alkaline phosphatase, intestinal (ALPI) 100 ug
$665.00
TP324178 Recombinant protein of human alkaline phosphatase, intestinal (ALPI), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.