CD252 (TNFSF4) (NM_003326) Human Mass Spec Standard

SKU PH324021

TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC224021]
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC224021 representing NM_003326; Red=Cloning site Green=Tags(s); ; MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK; KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV; ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003317
• RefSeq Size: 3510
• RefSeq ORF: 549
• Synonyms: CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1
• Locus ID: 7292
• UniProt ID: P23510
• Cytogenetics: 1q25.1
• Summary: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction