HIP55 (DBNL) (NM_001014436) Human Mass Spec Standard

SKU
PH323992
DBNL MS Standard C13 and N15-labeled recombinant protein (NP_001014436)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223992]
Predicted MW 48.3 kDa
Protein Sequence
Protein Sequence
>RC223992 protein sequence
Red=Cloning site Green=Tags(s)

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK
DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY
SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR
ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG
KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL
VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG
MFPANYVELIE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001014436
RefSeq Size 2210
RefSeq ORF 1293
Synonyms ABP1; HIP-55; HIP55; SH3P7
Locus ID 28988
UniProt ID Q9UJU6
Cytogenetics 7p13
Summary Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes (By similarity). May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HIP55 (DBNL) (NM_001014436) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303435 DBNL MS Standard C13 and N15-labeled recombinant protein (NP_054782) 10 ug
$3,255.00
LC402274 DBNL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423061 DBNL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426586 DBNL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402274 Transient overexpression lysate of drebrin-like (DBNL), transcript variant 1 100 ug
$436.00
LY423061 Transient overexpression lysate of drebrin-like (DBNL), transcript variant 2 100 ug
$665.00
LY426586 Transient overexpression lysate of drebrin-like (DBNL), transcript variant 3 100 ug
$436.00
TP303435 Recombinant protein of human drebrin-like (DBNL), transcript variant 1, 20 µg 20 ug
$867.00
TP323992 Recombinant protein of human drebrin-like (DBNL), transcript variant 2, 20 µg 20 ug
$867.00
TP710145 Recombinant protein of human drebrin-like (DBNL), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.