Dystrobrevin alpha (DTNA) (NM_032979) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223952] |
Predicted MW | 58.7 kDa |
Protein Sequence |
Protein Sequence
>RC223952 representing NM_032979
Red=Cloning site Green=Tags(s) MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNL DPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLC GGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFL DTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSH SNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLF SHSVPSSGSPFITRSMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIA ELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLE GLMKLLKEEELKQGVSYVPYCRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_116761 |
RefSeq Size | 3110 |
RefSeq ORF | 1539 |
Synonyms | D18S892E; DRP3; DTN; DTN-A; LVNC1 |
Locus ID | 1837 |
UniProt ID | Q9Y4J8 |
Cytogenetics | 18q12.1 |
Summary | The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313549 | DTNA MS Standard C13 and N15-labeled recombinant protein (NP_116762) | 10 ug |
$3,255.00
|
|
PH321162 | DTNA MS Standard C13 and N15-labeled recombinant protein (NP_001381) | 10 ug |
$3,255.00
|
|
LC409817 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409818 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409819 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419965 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434373 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC434375 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY409817 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 5 | 100 ug |
$665.00
|
|
LY409818 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 6 | 100 ug |
$436.00
|
|
LY409819 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 8 | 100 ug |
$436.00
|
|
LY419965 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 7 | 100 ug |
$436.00
|
|
LY434373 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 12 | 100 ug |
$665.00
|
|
LY434375 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 11 | 100 ug |
$665.00
|
|
TP313549 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321162 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323952 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.