BTN1A1 (NM_001732) Human Mass Spec Standard

SKU
PH323852
BTN1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001723)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223852]
Predicted MW 58.8 kDa
Protein Sequence
Protein Sequence
>RC223852 representing NM_001732
Red=Cloning site Green=Tags(s)

MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV
SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK
VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD
TSTKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR
NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR
ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD
LSKEIPLSPMGEESAPRDADTLHSKLIPTQPSQGAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001723
RefSeq Size 2901
RefSeq ORF 1578
Synonyms BT; BTN; BTN1
Locus ID 696
UniProt ID Q13410
Cytogenetics 6p22.2
Summary Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BTN1A1 (NM_001732) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400653 BTN1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400653 Transient overexpression lysate of butyrophilin, subfamily 1, member A1 (BTN1A1) 100 ug
$665.00
TP323852 Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1), 20 µg 20 ug
$867.00
TP720427 Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.