HEPACAM (NM_152722) Human Mass Spec Standard

SKU
PH323693
HEPACAM MS Standard C13 and N15-labeled recombinant protein (NP_689935)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223693]
Predicted MW 46 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC223693
Blue=ORF Red=Cloning site Green=Tag(s)

MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKW
QLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTIN
LTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRV
LMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQ
NSLEYMDQNDDRLKPEADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPA
VPGRSPGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEI
SA

myc-FLAG tag

Recombinant protein using RC223693 also available, TP323693
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689935
RefSeq Size 3258
RefSeq ORF 1248
Synonyms GlialCAM; HEPN1; MLC2A; MLC2B
Locus ID 220296
UniProt ID Q14CZ8
Cytogenetics 11q24.2
Summary The protein encoded by this gene is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. The encoded protein acts as a homodimer and is involved in cell motility and cell-matrix interactions. The expression of this gene is downregulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene. [provided by RefSeq, Jul 2011]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:HEPACAM (NM_152722) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407342 HEPACAM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407342 Transient overexpression lysate of hepatocyte cell adhesion molecule (HEPACAM) 100 ug
$665.00
TP323693 Recombinant protein of human hepatocyte cell adhesion molecule (HEPACAM), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.