Histone H2A Bbd (H2AFB2) (NM_001017991) Human Mass Spec Standard

SKU PH323551

H2AFB2 MS Standard C13 and N15-labeled recombinant protein (NP_001017991)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC223551]
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC223551 protein sequence; Red=Cloning site Green=Tags(s); ; MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL; AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001017991
• RefSeq Size: 594
• RefSeq ORF: 345
• Synonyms: H2A.Bbd; H2AB3; H2AFB2
• Locus ID: 474381
• UniProt ID: P0C5Z0
• Cytogenetics: Xq28
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015]
• Protein Pathways: Systemic lupus erythematosus