Exosome Component 9 (EXOSC9) (NM_001034194) Human Mass Spec Standard

SKU
PH323537
EXOSC9 MS Standard C13 and N15-labeled recombinant protein (NP_001029366)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223537]
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC223537 representing NM_001034194
Red=Cloning site Green=Tags(s)

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR
ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN
HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN
EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG
KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL
EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQELGFHHVGQTGLEFLTSDAPIILSDSEEEEMIILE
PDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001029366
RefSeq Size 1644
RefSeq ORF 1368
Synonyms p5; p6; PCH1D; PM/Scl-75; PMSCL1; RRP45; Rrp45p
Locus ID 5393
UniProt ID Q06265
Cytogenetics 4q27
Summary This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:Exosome Component 9 (EXOSC9) (NM_001034194) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421960 EXOSC9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421960 Transient overexpression lysate of exosome component 9 (EXOSC9), transcript variant 1 100 ug
$665.00
TP323537 Recombinant protein of human exosome component 9 (EXOSC9), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.