GDPD1 (NM_182569) Human Mass Spec Standard

SKU
PH323431
GDPD1 MS Standard C13 and N15-labeled recombinant protein (NP_872375)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223431]
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC223431 representing NM_182569
Red=Cloning site Green=Tags(s)

MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDT
LELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVF
EAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILG
LFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVL
NEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872375
RefSeq Size 1822
RefSeq ORF 942
Synonyms GDE4
Locus ID 284161
UniProt ID Q8N9F7
Cytogenetics 17q22
Summary This gene encodes a member of the glycerophosphodiester phosphodiesterase family of enzymes that catalyze the hydrolysis of deacylated glycerophospholipids to glycerol phosphate and alcohol. The encoded protein is localized to the cytoplasm and concentrates near the perinuclear region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GDPD1 (NM_182569) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405490 GDPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405490 Transient overexpression lysate of glycerophosphodiester phosphodiesterase domain containing 1 (GDPD1), transcript variant 1 100 ug
$436.00
TP323431 Recombinant protein of human glycerophosphodiester phosphodiesterase domain containing 1 (GDPD1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.