PPP1R14B (NM_138689) Human Mass Spec Standard

SKU
PH323367
PPP1R14B MS Standard C13 and N15-labeled recombinant protein (NP_619634)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223367]
Predicted MW 15.9 kDa
Protein Sequence
Protein Sequence
>RC223367 protein sequence
Red=Cloning site Green=Tags(s)

MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLN
LEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQK
LSTPQKK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_619634
RefSeq Size 1038
RefSeq ORF 441
Synonyms PHI-1; PLCB3N; PNG; SOM172
Locus ID 26472
UniProt ID Q96C90
Cytogenetics 11q13.1
Summary Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PPP1R14B (NM_138689) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408544 PPP1R14B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408544 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 14B (PPP1R14B) 100 ug
$436.00
TP323367 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14B (PPP1R14B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.