UPB1 (NM_016327) Human Mass Spec Standard

SKU
PH323365
UPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057411)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223365]
Predicted MW 43.2 kDa
Protein Sequence
Protein Sequence
>RC223365 protein sequence
Red=Cloning site Green=Tags(s)

MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQLRRPR
IVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAE
SAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTY
YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANH
CFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQV
NDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057411
RefSeq Size 2167
RefSeq ORF 1152
Synonyms BUP1
Locus ID 51733
UniProt ID Q9UBR1
Cytogenetics 22q11.23
Summary This gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. [provided by RefSeq, Jul 2008]
Protein Pathways beta-Alanine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Pantothenate and CoA biosynthesis, Pyrimidine metabolism
Write Your Own Review
You're reviewing:UPB1 (NM_016327) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414060 UPB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414060 Transient overexpression lysate of ureidopropionase, beta (UPB1) 100 ug
$436.00
TP323365 Recombinant protein of human ureidopropionase, beta (UPB1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720186 Recombinant protein of human ureidopropionase, beta (UPB1) 10 ug
$330.00
TP760830 Purified recombinant protein of Human ureidopropionase, beta (UPB1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.