NUDT13 (NM_015901) Human Mass Spec Standard

SKU
PH323356
NUDT13 MS Standard C13 and N15-labeled recombinant protein (NP_056985)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223356]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC223356 representing NM_015901
Red=Cloning site Green=Tags(s)

MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPR
HSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRK
ALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNVAGSKRVCPSNNIIYYPQMAPVAITLVSDGT
RCLLARQSSFPKGMYSALAGFCDIGESVEETIRREVAEEVGLEVESLQYYASQHWPFPSGSLMIACHATV
KPGQTEIQVNLRELETAAWFSHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSL
PA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056985
RefSeq Size 2120
RefSeq ORF 1056
Locus ID 25961
UniProt ID Q86X67
Cytogenetics 10q22.2
Summary NAD(P)H pyrophosphatase that hydrolyzes NADH into NMNH and AMP, and NADPH into NMNH and 2',5'-ADP. Has a marked preference for the reduced pyridine nucleotides. Does not show activity toward NAD-capped RNAs; the NAD-cap is an atypical cap present at the 5'-end of some RNAs.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NUDT13 (NM_015901) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414333 NUDT13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414333 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 13 (NUDT13) 100 ug
$436.00
TP323356 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 13 (NUDT13), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.