Aminoadipate aminotransferase (AADAT) (NM_016228) Human Mass Spec Standard
CAT#: PH323277
AADAT MS Standard C13 and N15-labeled recombinant protein (NP_057312)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223277 |
Predicted MW | 47.2 kDa |
Protein Sequence |
>RC223277 representing NM_016228
Red=Cloning site Green=Tags(s) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057312 |
RefSeq Size | 2326 |
RefSeq ORF | 1275 |
Synonyms | KAT2; KATII; KYAT2 |
Locus ID | 51166 |
UniProt ID | Q8N5Z0, Q4W5N8 |
Cytogenetics | 4q33 |
Summary | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Protein Pathways | Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405437 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC414111 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405437 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 2 |
USD 665.00 |
|
LY414111 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1 |
USD 436.00 |
|
PH322252 | AADAT MS Standard C13 and N15-labeled recombinant protein (NP_872603) |
USD 3,255.00 |
|
TP322252 | Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 2, 20 µg |
USD 867.00 |
|
TP323277 | Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review