Aminoadipate aminotransferase (AADAT) (NM_016228) Human Mass Spec Standard

SKU
PH323277
AADAT MS Standard C13 and N15-labeled recombinant protein (NP_057312)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223277]
Predicted MW 47.2 kDa
Protein Sequence
Protein Sequence
>RC223277 representing NM_016228
Red=Cloning site Green=Tags(s)

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR
ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP
AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS
ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL
IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP
AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057312
RefSeq Size 2326
RefSeq ORF 1275
Synonyms KAT2; KATII; KYAT2
Locus ID 51166
UniProt ID Q8N5Z0
Cytogenetics 4q33
Summary This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Protein Pathways Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:Aminoadipate aminotransferase (AADAT) (NM_016228) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322252 AADAT MS Standard C13 and N15-labeled recombinant protein (NP_872603) 10 ug
$3,255.00
LC405437 AADAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414111 AADAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405437 Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 2 100 ug
$665.00
LY414111 Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1 100 ug
$436.00
TP322252 Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323277 Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.