Aminoadipate aminotransferase (AADAT) (NM_182662) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222252] |
Predicted MW | 47.2 kDa |
Protein Sequence |
Protein Sequence
>RC222252 representing NM_182662
Red=Cloning site Green=Tags(s) MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL IKESL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_872603 |
RefSeq Size | 2108 |
RefSeq ORF | 1275 |
Synonyms | KAT2; KATII; KYAT2 |
Locus ID | 51166 |
UniProt ID | Q8N5Z0 |
Cytogenetics | 4q33 |
Summary | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Protein Pathways | Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323277 | AADAT MS Standard C13 and N15-labeled recombinant protein (NP_057312) | 10 ug |
$3,255.00
|
|
LC405437 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC414111 | AADAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405437 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 2 | 100 ug |
$665.00
|
|
LY414111 | Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1 | 100 ug |
$436.00
|
|
TP322252 | Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323277 | Recombinant protein of human aminoadipate aminotransferase (AADAT), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.