ASS1 (NM_000050) Human Mass Spec Standard

SKU
PH323189
ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_000041)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223189]
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC223189 protein sequence
Red=Cloning site Green=Tags(s)

MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE
EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK
VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT
QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG
IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ
VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000041
RefSeq Size 1863
RefSeq ORF 1236
Synonyms ASS; CTLN1
Locus ID 445
UniProt ID P00966
Cytogenetics 9q34.11
Summary The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012]
Protein Families Druggable Genome
Protein Pathways Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:ASS1 (NM_000050) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301130 ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_446464) 10 ug
$3,255.00
LC403289 ASS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424955 ASS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403289 Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 2 100 ug
$436.00
LY424955 Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 1 100 ug
$436.00
TP301130 Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 2, 20 µg 20 ug
$737.00
TP323189 Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1, 20 µg 20 ug
$737.00
TP720522 Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.