LDB3 (NM_001080115) Human Mass Spec Standard

SKU
PH323117
LDB3 MS Standard C13 and N15-labeled recombinant protein (NP_001073584)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223117]
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC223117 representing NM_001080115
Red=Cloning site Green=Tags(s)

MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIK
SASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRP
TFSPAFSRPSAFSSLAEASDPGPPRASLRAKTSPEGARDLLGPKALPGSSQPRQYNNPIGLYSAETLREM
AQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQ
MTGTEFMQDPDEEALRRSRERFETERNSPRFAKLRNWHHGLSAQILNVKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073584
RefSeq Size 1695
RefSeq ORF 990
Synonyms CMD1C; CMH24; CMPD3; CYPHER; LDB3Z1; LDB3Z4; LVNC3; MFM4; ORACLE; PDLIM6; ZASP
Locus ID 11155
UniProt ID O75112
Cytogenetics 10q23.2
Summary This gene encodes a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins interact with each other in cytoskeletal assembly or with other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM domains. The LIM domain is a cysteine-rich motif defined by 50-60 amino acids containing two zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this gene have been associated with myofibrillar myopathy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been identified; all isoforms have N-terminal PDZ domains while only longer isoforms (1, 2 and 5) have C-terminal LIM domains. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:LDB3 (NM_001080115) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323167 LDB3 MS Standard C13 and N15-labeled recombinant protein (NP_001073585) 10 ug
$3,255.00
LC421586 LDB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421587 LDB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421586 Transient overexpression lysate of LIM domain binding 3 (LDB3), transcript variant 3 100 ug
$436.00
LY421587 Transient overexpression lysate of LIM domain binding 3 (LDB3), transcript variant 4 100 ug
$436.00
TP323117 Purified recombinant protein of Homo sapiens LIM domain binding 3 (LDB3), transcript variant 3, 20 µg 20 ug
$867.00
TP323167 Recombinant protein of human LIM domain binding 3 (LDB3), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.