MLX (NM_198205) Human Mass Spec Standard

SKU
PH323064
MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223064]
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC223064 representing NM_198205
Red=Cloning site Green=Tags(s)

MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQT
IVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQD
NPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK
NQLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_937848
RefSeq Size 2316
RefSeq ORF 642
Synonyms bHLHd13; MAD7; MXD7; TCFL4; TF4
Locus ID 6945
UniProt ID Q9UH92
Cytogenetics 17q21.2
Summary The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:MLX (NM_198205) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301911 MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847) 10 ug
$3,255.00
LC404977 MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404978 MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406915 MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404977 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 2 100 ug
$436.00
LY404978 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 1 100 ug
$436.00
LY406915 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 100 ug
$436.00
TP301911 Recombinant protein of human MAX-like protein X (MLX), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323064 Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.