AOC2 (NM_009590) Human Mass Spec Standard

SKU
PH322991
AOC2 MS Standard C13 and N15-labeled recombinant protein (NP_033720)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222991]
Predicted MW 83.5 kDa
Protein Sequence
Protein Sequence
>RC222991 representing NM_009590
Red=Cloning site Green=Tags(s)

MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLSREELTAVMRF
LTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVG
PLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLAAVHATPR
GLRSGDRATWMALYHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRL
EVVRVPLPPPNGASSLRSRNSPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQG
ERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALEGRVHATGYIN
TAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQRPQL
TRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYRIQIHSPLGIHIPLESDMERALSWGRYQLVV
TQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL
LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_033720
RefSeq Size 2681
RefSeq ORF 2268
Synonyms DAO2; RAO; SSAO
Locus ID 314
UniProt ID O75106
Cytogenetics 17q21.31
Summary Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Protein Pathways beta-Alanine metabolism, Glycine, Metabolic pathways, Phenylalanine metabolism, serine and threonine metabolism, Tyrosine metabolism
Write Your Own Review
You're reviewing:AOC2 (NM_009590) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400465 AOC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416008 AOC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400465 Transient overexpression lysate of amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1 100 ug
$665.00
LY416008 Transient overexpression lysate of amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2 100 ug
$665.00
TP322991 Recombinant protein of human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.