ARHGAP9 (NM_001080156) Human Mass Spec Standard

SKU
PH322813
ARHGAP9 MS Standard C13 and N15-labeled recombinant protein (NP_001073625)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222813]
Predicted MW 61 kDa
Protein Sequence
Protein Sequence
>RC222813 representing NM_001080156
Red=Cloning site Green=Tags(s)

MSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNP
GSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVE
KSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGR
HLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLDRENPLELRLSGSGPAELSAGEDEEEE
SELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGD
TVPSFLRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTE
WDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLC
RVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073625
RefSeq Size 2102
RefSeq ORF 1641
Synonyms 10C; RGL1
Locus ID 64333
UniProt ID Q9BRR9
Cytogenetics 12q13.3
Summary This gene encodes a member of the Rho-GAP family of GTPase activating proteins. The protein has substantial GAP activity towards several Rho-family GTPases in vitro, converting them to an inactive GDP-bound state. It is implicated in regulating adhesion of hematopoietic cells to the extracellular matrix. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ARHGAP9 (NM_001080156) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421603 ARHGAP9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421604 ARHGAP9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421603 Transient overexpression lysate of Rho GTPase activating protein 9 (ARHGAP9), transcript variant 3 100 ug
$665.00
LY421604 Transient overexpression lysate of Rho GTPase activating protein 9 (ARHGAP9), transcript variant 2 100 ug
$665.00
TP322813 Recombinant protein of human Rho GTPase activating protein 9 (ARHGAP9), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.