MCK10 (DDR1) (NM_013993) Human Mass Spec Standard

SKU
PH322767
DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054699)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222767]
Predicted MW 100.9 kDa
Protein Sequence
Protein Sequence
>RC222767 representing NM_013993
Red=Cloning site Green=Tags(s)

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD
GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV
ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL
NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR
GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP
PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD
SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI
TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR
NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL
NTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054699
RefSeq Size 3877
RefSeq ORF 2739
Synonyms CAK; CD167; DDR; EDDR1; HGK2; MCK10; NEP; NTRK4; PTK3; PTK3A; RTK6; TRKE
Locus ID 780
UniProt ID Q08345
Cytogenetics 6p21.33
Summary Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of tyrosine kinase receptors with homology to Dictyostelium discoideum protein discoidin I in their extracellular domain, and that are activated by various types of collagen. Expression of this protein is restricted to epithelial cells, particularly in the kidney, lung, gastrointestinal tract, and brain. In addition, it has been shown to be significantly overexpressed in several human tumors. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Write Your Own Review
You're reviewing:MCK10 (DDR1) (NM_013993) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322819 DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054700) 10 ug
$3,255.00
LC400719 DDR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415575 DDR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415576 DDR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400719 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2 100 ug
$436.00
LY415575 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 100 ug
$665.00
LY415576 Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 100 ug
$665.00
TP322767 Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, 20 µg 20 ug
$737.00
TP322819 Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3, 20 µg 20 ug
$737.00
TP700161 Purified recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP710141 Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, residues 21-417aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP710264 Purified recombinant protein of Human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.