MAD1 (MAD1L1) (NM_001013836) Human Mass Spec Standard

SKU
PH322718
MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001013858)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222718]
Predicted MW 83.1 kDa
Protein Sequence
Protein Sequence
>RC222718 protein sequence
Red=Cloning site Green=Tags(s)

MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVERE
KMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDA
ASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQE
LQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQ
EELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKD
KNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQS
FLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLRED
HSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFR
KACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSI
PAFLSSLTLELFSRQTVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001013858
RefSeq Size 2717
RefSeq ORF 2154
Synonyms MAD1; PIG9; TP53I9; TXBP181
Locus ID 8379
UniProt ID Q9Y6D9
Cytogenetics 7p22.3
Summary MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome
Protein Pathways Cell cycle
Write Your Own Review
You're reviewing:MAD1 (MAD1L1) (NM_001013836) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303471 MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_003541) 10 ug
$3,255.00
LC401184 MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423037 MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423038 MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401184 Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1 100 ug
$436.00
LY423037 Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2 100 ug
$665.00
LY423038 Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 3 100 ug
$665.00
TP303471 Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322718 Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.