PKM2 (PKM) (NM_182471) Human Mass Spec Standard

SKU
PH322698
PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872271)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222698]
Predicted MW 57.9 kDa
Protein Sequence
Protein Sequence
>RC222698 representing NM_182471
Red=Cloning site Green=Tags(s)

MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN
VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL
KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN
LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF
DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN
AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV
NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872271
RefSeq Size 2498
RefSeq ORF 1593
Synonyms CTHBP; HEL-S-30; OIP3; p58; PK3; PKM2; TCB; THBP1
Locus ID 5315
UniProt ID P14618
Cytogenetics 15q23
Summary This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. [provided by RefSeq, May 2011]
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus
Write Your Own Review
You're reviewing:PKM2 (PKM) (NM_182471) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301855 PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645) 10 ug
$3,255.00
PH319382 PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270) 10 ug
$3,255.00
LC405537 PKM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405538 PKM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419188 PKM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405537 Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 2 100 ug
$665.00
LY405538 Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3 100 ug
$665.00
LY419188 Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1 100 ug
$436.00
TP301855 Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 1, 20 µg 20 ug
$737.00
TP319382 Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 2, 20 µg 20 ug
$737.00
TP322698 Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 3, 20 µg 20 ug
$737.00
TP721212 Purified recombinant protein of Human pyruvate kinase, muscle (PKM2), transcript variant 1 10 ug
$215.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.