ASIP (NM_001672) Human Mass Spec Standard

SKU
PH322654
ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222654]
Predicted MW 14.52 kDa
Protein Sequence
Protein Sequence
>RC222654 representing NM_001672
Red=Cloning site Green=Tags(s)

MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK
RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001663
RefSeq Size 584
RefSeq ORF 396
Synonyms AGSW; AGTI; AGTIL; ASP; SHEP9
Locus ID 434
UniProt ID P42127
Cytogenetics 20q11.22
Summary In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Protein Pathways Melanogenesis
Write Your Own Review
You're reviewing:ASIP (NM_001672) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419812 ASIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419812 Transient overexpression lysate of agouti signaling protein, nonagouti homolog (mouse) (ASIP) 100 ug
$436.00
TP322654 Recombinant protein of human agouti signaling protein, nonagouti homolog (mouse) (ASIP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701037 Purified recombinant protein of Human agouti signaling protein (ASIP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.