OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKHD1 (NM_024668) Human Mass Spec Standard

Be the first to review this product
SKU
PH322623
ANKHD1 MS Standard C13 and N15-labeled recombinant protein (NP_078944)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349682 Rabbit Polyclonal Anti-ANKHD1 Antibody
100 ul
$205.00
LY411184 Transient overexpression lysate of ankyrin repeat and KH domain containing 1 (ANKHD1), transcript variant 3 (as WB positive control) 100 ug
$665.00

Other products for "ANKHD1 or NM_024668"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222623
Predicted MW 64.9 kDa
Protein Sequence
Protein Sequence
>RC222623 representing NM_024668
Red=Cloning site Green=Tags(s)

MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPASGVGSSGGGGSGSGTGG
GDAALDFKLAAAVLRTGGGGGASGSDEDEVSEVESFILDQEDLDNPVLKTTSEIFLSSTAEGADLRTVDP
ETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAENSHNAGQVDTRSLA
EACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAAS
SGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGH
VEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEV
ARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALL
LAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLASGAN
VHATTATGDTALTYACENGHTDVADVLLQAGADLDKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078944
RefSeq Size 2194
RefSeq ORF 1881
Synonyms MASK; MASK1; PP2500; VBARP
Locus ID 54882
UniProt ID Q8IWZ3
Cytogenetics 5q31.3
Summary This gene encodes a protein with multiple ankyrin repeat domains and a single KH-domain. The protein is thought to function as a scaffolding protein, and it may be involved in the regulation of caspases and thereby play an antiapoptotic role in cell survival. Alternative splicing results in multiple transcript variants, one of which generates a fusion transcript (MASK-BP3) with the downstream eIF4E-binding protein 3 (EIF4EBP3) gene, resulting in a protein comprised of the ANKHD1 sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. provided by RefSeq, Sep 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKHD1" proteins (5)
SKU Description Size Price
LC411184 Lyophilized ANKHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413410 Lyophilized ANKHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411184 Transient overexpression lysate of ankyrin repeat and KH domain containing 1 (ANKHD1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY413410 Transient overexpression lysate of ankyrin repeat and KH domain containing 1 (ANKHD1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP322623 Recombinant protein of human ankyrin repeat and KH domain containing 1 (ANKHD1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products