USP16 (NM_006447) Human Mass Spec Standard

SKU
PH322609
USP16 MS Standard C13 and N15-labeled recombinant protein (NP_006438)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222609]
Predicted MW 93.4 kDa
Protein Sequence
Protein Sequence
>RC222609 representing NM_006447
Red=Cloning site Green=Tags(s)

MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPS
VWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRK
QASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAV
MQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKE
LFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKS
MPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGE
VNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGA
YLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDE
CSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRF
QQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANS
HLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006438
RefSeq Size 2989
RefSeq ORF 2469
Synonyms UBP-M; UBPM
Locus ID 10600
UniProt ID Q9Y5T5
Cytogenetics 21q21.3
Summary This gene encodes a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Protease
Write Your Own Review
You're reviewing:USP16 (NM_006447) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416633 USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422330 USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424308 USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416633 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 1 100 ug
$436.00
LY422330 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 3 100 ug
$665.00
LY424308 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 2 100 ug
$436.00
TP322609 Recombinant protein of human ubiquitin specific peptidase 16 (USP16), transcript variant 1, 20 µg 20 ug
$867.00
TP762091 Purified recombinant protein of Human ubiquitin specific peptidase 16 (USP16), transcript variant 2,Met1-Asp355, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.