ANKS1B (NM_020140) Human Mass Spec Standard

SKU
PH322572
ANKS1B MS Standard C13 and N15-labeled recombinant protein (NP_064525)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222572]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC222572 representing NM_020140
Red=Cloning site Green=Tags(s)

MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGS
NVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGYTSMD
LLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRTGDWGEPSITLRPPNEATASTP
VQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGV
KFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEV
AYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064525
RefSeq Size 1714
RefSeq ORF 1242
Synonyms AIDA; AIDA-1; ANKS2; cajalin-2; EB-1; EB1
Locus ID 56899
UniProt ID Q7Z6G8
Cytogenetics 12q23.1
Summary This gene encodes a multi-domain protein that is predominantly expressed in brain and testis. This protein interacts with amyloid beta protein precursor (AbetaPP) and may have a role in normal brain development, and in the pathogenesis of Alzheimer's disease. Expression of this gene has been shown to be elevated in patients with pre-B cell acute lymphocytic leukemia associated with t(1;19) translocation. Alternatively spliced transcript variants encoding different isoforms (some with different subcellular localization, PMID:15004329) have been described for this gene. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:ANKS1B (NM_020140) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405556 ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407279 ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412629 ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405556 Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 2 100 ug
$665.00
LY407279 Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 1 100 ug
$665.00
LY412629 Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3 100 ug
$436.00
TP322572 Recombinant protein of human ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.