Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Mass Spec Standard

SKU PH322455

MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC222455]
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC222455 representing NM_206809; Red=Cloning site Green=Tags(s); ; MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR; PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM; ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT; LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_996532
• RefSeq Size: 2119
• RefSeq ORF: 741
• Synonyms: BTN6; BTNL11; MOGIG2; NRCLP7
• Locus ID: 4340
• UniProt ID: Q16653
• Cytogenetics: 6p22.1
• Summary: The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane