DOK3 (NM_024872) Human Mass Spec Standard

SKU
PH322370
DOK3 MS Standard C13 and N15-labeled recombinant protein (NP_079148)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222370]
Predicted MW 53.1 kDa
Protein Sequence
Protein Sequence
>RC222370 representing NM_024872
Red=Cloning site Green=Tags(s)

MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPLETPIKDGILY
QQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPGRRGERRVIRLADCVSVLPAD
GESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSS
WQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKLGSDKGVFSFEAGR
RCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPP
TSRKMHLAEPGPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG
PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRERRKGP
APCDRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079148
RefSeq Size 1762
RefSeq ORF 1488
Synonyms DOKL
Locus ID 79930
UniProt ID Q7L591
Cytogenetics 5q35.3
Summary DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK3 is a negative regulator of JNK signaling in B-cells through interaction with INPP5D/SHIP1. May modulate ABL1 function (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:DOK3 (NM_024872) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411036 DOK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428537 DOK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411036 Transient overexpression lysate of docking protein 3 (DOK3), transcript variant 1 100 ug
$665.00
LY428537 Transient overexpression lysate of docking protein 3 (DOK3), transcript variant 3 100 ug
$436.00
TP322370 Purified recombinant protein of Homo sapiens docking protein 3 (DOK3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.