EXOC7 (NM_015219) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222329] |
Predicted MW | 74.5 kDa |
Protein Sequence |
Protein Sequence
>RC222329 representing NM_015219
Red=Cloning site Green=Tags(s) MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGRDDMLDVETD AYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTV FPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHEL TSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNLLSKSKVYEDPAL SAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGV KLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_056034 |
RefSeq Size | 4687 |
RefSeq ORF | 1959 |
Synonyms | 2-5-3p; BLOM4; EX070; EXO70; Exo70p; EXOC1; NEDSEBA; YJL085W |
Locus ID | 23265 |
UniProt ID | Q9UPT5 |
Cytogenetics | 17q25.1 |
Summary | The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Nov 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Insulin signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH327527 | EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_001138771) | 10 ug |
$3,255.00
|
|
LC428802 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC428803 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY428802 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 5 | 100 ug |
$665.00
|
|
LY428803 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 6 | 100 ug |
$665.00
|
|
TP322329 | Recombinant protein of human exocyst complex component 7 (EXOC7), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327527 | Purified recombinant protein of Homo sapiens exocyst complex component 7 (EXOC7), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.