CDK10 (NM_052988) Human Mass Spec Standard

SKU
PH322310
CDK10 MS Standard C13 and N15-labeled recombinant protein (NP_443714)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222310]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC222310 representing NM_052988
Red=Cloning site Green=Tags(s)

MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV
RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV
KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL
LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ
PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT
SEGQSKRCKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443714
RefSeq Size 1803
RefSeq ORF 1080
Synonyms ALSAS; PISSLRE
Locus ID 8558
UniProt ID Q15131
Cytogenetics 16q24.3
Summary The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:CDK10 (NM_052988) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409344 CDK10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409345 CDK10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409344 Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant b 100 ug
$436.00
LY409345 Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant a 100 ug
$436.00
TP322310 Recombinant protein of human cyclin-dependent kinase 10 (CDK10), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.