CDK10 (NM_052988) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222310] |
Predicted MW | 40.9 kDa |
Protein Sequence |
Protein Sequence
>RC222310 representing NM_052988
Red=Cloning site Green=Tags(s) MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT SEGQSKRCKP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_443714 |
RefSeq Size | 1803 |
RefSeq ORF | 1080 |
Synonyms | ALSAS; PISSLRE |
Locus ID | 8558 |
UniProt ID | Q15131 |
Cytogenetics | 16q24.3 |
Summary | The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle progression. This kinase has been shown to play a role in cellular proliferation and its function is limited to cell cycle G2-M phase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC409344 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409345 | CDK10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409344 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant b | 100 ug |
$436.00
|
|
LY409345 | Transient overexpression lysate of cyclin-dependent kinase 10 (CDK10), transcript variant a | 100 ug |
$436.00
|
|
TP322310 | Recombinant protein of human cyclin-dependent kinase 10 (CDK10), transcript variant a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.