Motilin (MLN) (NM_002418) Human Mass Spec Standard

SKU PH322245

MLN MS Standard C13 and N15-labeled recombinant protein (NP_002409)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC222245]
• Predicted MW: 12.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC222245 protein sequence; Red=Cloning site Green=Tags(s); ; MVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIR; EEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002409
• RefSeq Size: 572
• RefSeq ORF: 345
• Locus ID: 4295
• UniProt ID: P12872
• Cytogenetics: 6p21.31
• Summary: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. [provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane