Adenylate kinase 5 (AK5) (NM_174858) Human Mass Spec Standard

SKU
PH322241
AK5 MS Standard C13 and N15-labeled recombinant protein (NP_777283)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222241]
Predicted MW 63.2 kDa
Protein Sequence
Protein Sequence
>RC222241 representing NM_174858
Red=Cloning site Green=Tags(s)

MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPL
NGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGG
PGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIP
DEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQ
NAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDY
EDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSA
DTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDS
IF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777283
RefSeq Size 3257
RefSeq ORF 1686
Synonyms AK6
Locus ID 26289
UniProt ID Q9Y6K8
Cytogenetics 1p31.1
Summary This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism
Write Your Own Review
You're reviewing:Adenylate kinase 5 (AK5) (NM_174858) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306127 AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225) 10 ug
$3,255.00
LC403569 AK5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415983 AK5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403569 Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 1 100 ug
$436.00
LY415983 Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 2 100 ug
$436.00
TP306127 Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322241 Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.