DMAP1 (NM_019100) Human Mass Spec Standard

SKU
PH322239
DMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061973)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222239]
Predicted MW 53 kDa
Protein Sequence
Protein Sequence
>RC222239 protein sequence
Red=Cloning site Green=Tags(s)

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPP
LLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSE
QEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPG
TDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAE
QRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGV
ELSPTPTEELVHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE
PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061973
RefSeq Size 1784
RefSeq ORF 1401
Synonyms DNMAP1; DNMTAP1; EAF2; MEAF2; SWC4
Locus ID 55929
UniProt ID Q9NPF5
Cytogenetics 1p34.1
Summary This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:DMAP1 (NM_019100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412758 DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421951 DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421952 DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412758 Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 1 100 ug
$665.00
LY421951 Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 2 100 ug
$436.00
LY421952 Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 3 100 ug
$436.00
TP322239 Recombinant protein of human DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.