POLE2 (NM_002692) Human Mass Spec Standard

SKU
PH322113
POLE2 MS Standard C13 and N15-labeled recombinant protein (NP_002683)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222113]
Predicted MW 59.5 kDa
Protein Sequence
Protein Sequence
>RC222113 protein sequence
Red=Cloning site Green=Tags(s)

MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAA
VQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQR
THRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSK
AQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEE
ENKDAMFVFLSDVWLDQVEVLEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIIC
EYPDIHQSSRFVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTTT
NTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002683
RefSeq Size 1861
RefSeq ORF 1581
Synonyms DPE2
Locus ID 5427
UniProt ID P56282
Cytogenetics 14q21.3
Summary DNA polymerase epsilon, which is involved in DNA repair and replication, is composed of a large catalytic subunit and a small accessory subunit. The protein encoded by this gene represents the small subunit (B). Defects in this gene have been linked to colorectal cancer and to combined immunodeficiency. [provided by RefSeq, Jan 2017]
Protein Pathways Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:POLE2 (NM_002692) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419159 POLE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419159 Transient overexpression lysate of polymerase (DNA directed), epsilon 2 (p59 subunit) (POLE2) 100 ug
$665.00
TP322113 Recombinant protein of human polymerase (DNA directed), epsilon 2 (p59 subunit) (POLE2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.