SLC34A3 (NM_080877) Human Mass Spec Standard

SKU
PH322058
SLC34A3 MS Standard C13 and N15-labeled recombinant protein (NP_543153)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222058]
Predicted MW 63.3 kDa
Protein Sequence
Protein Sequence
>RC222058 representing NM_080877
Red=Cloning site Green=Tags(s)

MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVA
GSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVAGLVIGVLVTALVQSSSTSSS
IVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLE
SATALLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTG
QPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVL
RGRVAQVVRTVINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVVTARYRWVAGV
YLLLGFLLLPLAAFGLSLAGGMVLAAVGGPLVGLVLLVILVTVLQRRRPAWLPVRLRSWAWLPVWLHSLE
PWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_543153
RefSeq Size 2124
RefSeq ORF 1797
Synonyms HHRH; NPTIIc
Locus ID 142680
UniProt ID Q8N130
Cytogenetics 9q34.3
Summary This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.[provided by RefSeq, Apr 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC34A3 (NM_080877) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408994 SLC34A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433328 SLC34A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408994 Transient overexpression lysate of solute carrier family 34 (sodium phosphate), member 3 (SLC34A3) 100 ug
$665.00
LY433328 Transient overexpression lysate of solute carrier family 34 (sodium phosphate), member 3 (SLC34A3), transcript variant 1 100 ug
$436.00
TP322058 Purified recombinant protein of Homo sapiens solute carrier family 34 (sodium phosphate), member 3 (SLC34A3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.