Thymosin beta 4 (TMSB4X) (NM_021109) Human Mass Spec Standard

SKU PH322017

TMSB4X MS Standard C13 and N15-labeled recombinant protein (NP_066932)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC222017]
• Predicted MW: 5.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC222017 representing NM_021109; Red=Cloning site Green=Tags(s); ; MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_066932
• RefSeq Size: 657
• RefSeq ORF: 132
• Synonyms: FX; PTMB4; TB4X; TMSB4
• Locus ID: 7114
• UniProt ID: P62328
• Cytogenetics: Xp22.2
• Summary: This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]
• Protein Pathways: Regulation of actin cytoskeleton