Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Mass Spec Standard

SKU
PH322010
DYNC1LI1 MS Standard C13 and N15-labeled recombinant protein (NP_057225)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222010]
Predicted MW 56.6 kDa
Protein Sequence
Protein Sequence
>RC222010 protein sequence
Red=Cloning site Green=Tags(s)

MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV
LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS
LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR
RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA
ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE
DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK
PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057225
RefSeq Size 2517
RefSeq ORF 1569
Synonyms DLC-A; DNCLI1; LIC1
Locus ID 51143
UniProt ID Q9Y6G9
Cytogenetics 3p22.3
Summary The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414168 DYNC1LI1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414168 Transient overexpression lysate of dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1) 100 ug
$665.00
TP322010 Recombinant protein of human dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760668 Purified recombinant protein of Human dynein, cytoplasmic 1, light intermediate chain 1 (DYNC1LI1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.