Repulsive Guidance Molecule A (RGMA) (NM_020211) Human Mass Spec Standard

SKU
PH321996
RGMA MS Standard C13 and N15-labeled recombinant protein (NP_064596)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221996]
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC221996 representing NM_020211
Red=Cloning site Green=Tags(s)

MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD
DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD
SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA
TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT
IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT
APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDL
PGRAAAGLPLAPRPLLGALVPLLALLPVFCSGP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064596
RefSeq Size 3216
RefSeq ORF 1359
Synonyms RGM
Locus ID 56963
UniProt ID Q96B86
Cytogenetics 15q26.1
Summary This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:Repulsive Guidance Molecule A (RGMA) (NM_020211) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402781 RGMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433077 RGMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433079 RGMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433119 RGMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402781 Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 4 100 ug
$665.00
LY433077 Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 3 100 ug
$436.00
LY433079 Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 2 100 ug
$436.00
LY433119 Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 1 100 ug
$436.00
TP321996 Recombinant protein of human RGM domain family, member A (RGMA), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721172 Purified recombinant protein of Human RGM domain family, member A (RGMA), transcript variant 4 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.