Repulsive Guidance Molecule A (RGMA) (NM_020211) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221996] |
Predicted MW | 49.2 kDa |
Protein Sequence |
Protein Sequence
>RC221996 representing NM_020211
Red=Cloning site Green=Tags(s) MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDL PGRAAAGLPLAPRPLLGALVPLLALLPVFCSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_064596 |
RefSeq Size | 3216 |
RefSeq ORF | 1359 |
Synonyms | RGM |
Locus ID | 56963 |
UniProt ID | Q96B86 |
Cytogenetics | 15q26.1 |
Summary | This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC402781 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC433077 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433079 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433119 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402781 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 4 | 100 ug |
$665.00
|
|
LY433077 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 3 | 100 ug |
$436.00
|
|
LY433079 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 2 | 100 ug |
$436.00
|
|
LY433119 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 1 | 100 ug |
$436.00
|
|
TP321996 | Recombinant protein of human RGM domain family, member A (RGMA), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP721172 | Purified recombinant protein of Human RGM domain family, member A (RGMA), transcript variant 4 | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.