LIN7 (LIN7A) (NM_004664) Human Mass Spec Standard

SKU
PH321902
LIN7A MS Standard C13 and N15-labeled recombinant protein (NP_004655)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221902]
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC221902 protein sequence
Red=Cloning site Green=Tags(s)

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ
YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG
GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ
QQQLLIQQQQQQQQQQTQQNHMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004655
RefSeq Size 1235
RefSeq ORF 699
Synonyms LIN-7A; LIN7; MALS-1; MALS1; TIP-33; VELI1
Locus ID 8825
UniProt ID O14910
Cytogenetics 12q21.31
Summary The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain. [provided by RefSeq, May 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:LIN7 (LIN7A) (NM_004664) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417838 LIN7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417838 Transient overexpression lysate of lin-7 homolog A (C. elegans) (LIN7A) 100 ug
$436.00
TP321902 Recombinant protein of human lin-7 homolog A (C. elegans) (LIN7A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.