CK1 epsilon (CSNK1E) (NM_001894) Human Mass Spec Standard

SKU
PH321884
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221884]
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC221884 protein sequence
Red=Cloning site Green=Tags(s)

MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS
TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001885
RefSeq Size 2670
RefSeq ORF 1248
Synonyms CKIe; CKIepsilon; HCKIE
Locus ID 1454
UniProt ID P49674
Cytogenetics 22q13.1
Summary The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway
Write Your Own Review
You're reviewing:CK1 epsilon (CSNK1E) (NM_001894) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302436 CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407) 10 ug
$3,255.00
LC403455 CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419672 CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403455 Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1 100 ug
$436.00
LY419672 Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2 100 ug
$436.00
TP302436 Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 20 µg 20 ug
$737.00
TP321884 Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.