OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CK1 epsilon (CSNK1E) (NM_001894) Human Mass Spec Standard

Be the first to review this product
SKU
PH321884
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803799 CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4) 100 ul
$447.00
LY403455 Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CK1 epsilon or NM_001894"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221884
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC221884 protein sequence
Red=Cloning site Green=Tags(s)

MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS
TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001885
RefSeq Size 2670
RefSeq ORF 1248
Synonyms CKIe; CKIepsilon; HCKIE
Locus ID 1454
UniProt ID P49674
Cytogenetics 22q13.1
Summary The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Feb 2014
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CK1 epsilon" proteins (7)
SKU Description Size Price
PH302436 CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407) 10 ug
$3,360.00
LC403455 Lyophilized CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419672 Lyophilized CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403455 Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY419672 Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302436 Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 20 µg 20 ug
$737.00
TP321884 Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products