RABGGTA (NM_004581) Human Mass Spec Standard

SKU
PH321822
RABGGTA MS Standard C13 and N15-labeled recombinant protein (NP_004572)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221822]
Predicted MW 64.9 kDa
Protein Sequence
Protein Sequence
>RC221822 representing NM_004581
Red=Cloning site Green=Tags(s)

MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR
EVLQQLETQKSPEELAALVKAELGFLESCLRVNPKSYGTWHHRCWLLGRLPEPNWTRELELCARFLEVDE
RNFHCWDYRRFVATQAAVPPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLK
ELELVQNAFFTDPNDQSAWFYHRWLLGRADPQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDD
SPLIVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQ
LFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFQTLKAVDPMRAT
YLDDLRSKFLLENSVLKMEYAEVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRTLPPALAALRCLEV
LQASDNAIESLDGVTNLPRLQELLLCNNRLQQPAVLQPLASCPRLVLLNLQGNPLCQAVGILEQLAELLP
SVSSVLT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004572
RefSeq Size 2218
RefSeq ORF 1701
Synonyms PTAR3
Locus ID 5875
UniProt ID Q92696
Cytogenetics 14q12
Summary Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RABGGTA (NM_004581) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405377 RABGGTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417891 RABGGTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405377 Transient overexpression lysate of Rab geranylgeranyltransferase, alpha subunit (RABGGTA), transcript variant 1 100 ug
$436.00
LY417891 Transient overexpression lysate of Rab geranylgeranyltransferase, alpha subunit (RABGGTA), transcript variant 2 100 ug
$665.00
TP321822 Recombinant protein of human Rab geranylgeranyltransferase, alpha subunit (RABGGTA), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.