ART5 (NM_001079536) Human Mass Spec Standard

SKU
PH321774
ART5 MS Standard C13 and N15-labeled recombinant protein (NP_001073004)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221774]
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC221774 protein sequence
Red=Cloning site Green=Tags(s)

MALAALMIALGSLGLHTWQAQAVPTILPLGLAPDTFDDTYVGCVEEMEEKAAPLLKEEMAHHALLRESWE
AAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIR
ALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAP
IQAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTG
DLHMTKRHLQQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073004
RefSeq Size 1249
RefSeq ORF 876
Synonyms ARTC5
Locus ID 116969
UniProt ID Q96L15
Cytogenetics 11p15.4
Summary The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:ART5 (NM_001079536) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421524 ART5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421524 Transient overexpression lysate of ADP-ribosyltransferase 5 (ART5), transcript variant 2 100 ug
$436.00
TP321774 Recombinant protein of human ADP-ribosyltransferase 5 (ART5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.