NCBP2 (NM_001042540) Human Mass Spec Standard

SKU PH321605

NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC221605]
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC221605 representing NM_001042540; Red=Cloning site Green=Tags(s); ; MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGR; QYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ; ; SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001036005
• RefSeq Size: 2016
• RefSeq ORF: 309
• Synonyms: CBC2; CBP20; NIP1; PIG55
• Locus ID: 22916
• UniProt ID: P52298
• Cytogenetics: 3q29
• Summary: The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome