CED6 (GULP1) (NM_016315) Human Mass Spec Standard

SKU
PH321580
GULP1 MS Standard C13 and N15-labeled recombinant protein (NP_057399)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221580]
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC221580 representing NM_016315
Red=Cloning site Green=Tags(s)

MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV
ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT
IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK
SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM
QEGFKMGLTLEGTVFCLDPLDSRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057399
RefSeq Size 3464
RefSeq ORF 912
Synonyms CED-6; CED6; GULP
Locus ID 51454
UniProt ID Q9UBP9
Cytogenetics 2q32.1-q32.2
Summary The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by RefSeq, Nov 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CED6 (GULP1) (NM_016315) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414050 GULP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414050 Transient overexpression lysate of GULP, engulfment adaptor PTB domain containing 1 (GULP1) 100 ug
$436.00
TP321580 Recombinant protein of human GULP, engulfment adaptor PTB domain containing 1 (GULP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.