OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

A1BG (NM_130786) Human Mass Spec Standard

Be the first to review this product
SKU
PH321406
A1BG MS Standard C13 and N15-labeled recombinant protein (NP_570602)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383643 A1BG Rabbit polyclonal Antibody
100 ul
$380.00
LY408945 Transient overexpression lysate of alpha-1-B glycoprotein (A1BG) (as WB positive control) 100 ug
$665.00

Other products for "A1BG or NM_130786"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221406
Predicted MW 51.9 kDa
Protein Sequence
Protein Sequence
>RC221406 representing NM_130786
Red=Cloning site Green=Tags(s)

MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPV
HLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCR
GVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPP
VLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCR
YRLHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQ
SPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELSDPVEL
LVAES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570602
RefSeq Size 3386
RefSeq ORF 1485
Synonyms A1B; ABG; GAB; HYST2477
Locus ID 1
UniProt ID P04217
Cytogenetics 19q13.43
Summary The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "A1BG" proteins (3)
SKU Description Size Price
LC408945 Lyophilized A1BG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408945 Transient overexpression lysate of alpha-1-B glycoprotein (A1BG) (as WB positive control) 100 ug
$665.00
TP321406 Recombinant protein of human alpha-1-B glycoprotein (A1BG), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products