ZDHHC15 (NM_144969) Human Mass Spec Standard

SKU
PH321105
ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221105]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC221105 representing NM_144969
Red=Cloning site Green=Tags(s)

MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW
TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD
RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK
FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF
WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659406
RefSeq Size 1782
RefSeq ORF 1011
Synonyms DHHC15; MRX91
Locus ID 158866
UniProt ID Q96MV8
Cytogenetics Xq13.3
Summary The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ZDHHC15 (NM_144969) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403407 ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431287 ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403407 Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 1 100 ug
$436.00
LY431287 Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 2 100 ug
$436.00
TP321105 Recombinant protein of human zinc finger, DHHC-type containing 15 (ZDHHC15), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.