IRAK1BP1 (NM_001010844) Human Mass Spec Standard

SKU
PH321020
IRAK1BP1 MS Standard C13 and N15-labeled recombinant protein (NP_001010844)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221020]
Predicted MW 29.1 kDa
Protein Sequence
Protein Sequence
>RC221020 protein sequence
Red=Cloning site Green=Tags(s)

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQV
VVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQN
ICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKE
WEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001010844
RefSeq Size 3464
RefSeq ORF 780
Synonyms AIP70; SIMPL
Locus ID 134728
UniProt ID Q5VVH5
Cytogenetics 6q14.1
Summary Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:IRAK1BP1 (NM_001010844) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423178 IRAK1BP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423178 Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 binding protein 1 (IRAK1BP1) 100 ug
$436.00
TP321020 Recombinant protein of human interleukin-1 receptor-associated kinase 1 binding protein 1 (IRAK1BP1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.