TBX3 (NM_005996) Human Mass Spec Standard

SKU
PH320990
TBX3 MS Standard C13 and N15-labeled recombinant protein (NP_005987)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220990]
Predicted MW 77 kDa
Protein Sequence
Protein Sequence
>RC220990 representing NM_005996
Red=Cloning site Green=Tags(s)

MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVG
AAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRC
SGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLT
NNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCP
SEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDKASPDSRHSPA
TISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAAAHLAQGPLPGLGFAPGLAGQ
QFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPF
HLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVP
DGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE
LQSIQRLVSGLEAKPDRSRSASP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005987
RefSeq Size 4754
RefSeq ORF 2169
Synonyms TBX3-ISO; UMS; XHL
Locus ID 6926
UniProt ID O15119
Cytogenetics 12q24.21
Summary This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:TBX3 (NM_005996) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306829 TBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057653) 10 ug
$3,255.00
LC413892 TBX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416941 TBX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429275 TBX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413892 Transient overexpression lysate of T-box 3 (TBX3), transcript variant 2 100 ug
$436.00
LY416941 Transient overexpression lysate of T-box 3 (TBX3), transcript variant 1 100 ug
$665.00
TP306829 Recombinant protein of human T-box 3 (TBX3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320990 Recombinant protein of human T-box 3 (TBX3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.