Nogo A (RTN4) (NM_207520) Human Mass Spec Standard

SKU
PH320981
RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_997403)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220981]
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC220981 representing NM_207520
Red=Cloning site Green=Tags(s)

MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPT
APAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPP
ARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAVVDLLY
WRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE
VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFS
VPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997403
RefSeq Size 2471
RefSeq ORF 1176
Synonyms ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Locus ID 57142
UniProt ID Q9NQC3
Cytogenetics 2p16.1
Summary This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Nogo A (RTN4) (NM_207520) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321080 RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_008939) 10 ug
$3,255.00
LC402073 RTN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403920 RTN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412411 RTN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429630 RTN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402073 Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 3 100 ug
$436.00
LY403920 Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 4 100 ug
$436.00
LY412411 Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 100 ug
$665.00
LY429630 Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 100 ug
$665.00
TP320981 Recombinant protein of human reticulon 4 (RTN4), transcript variant 4, 20 µg 20 ug
$737.00
TP321080 Recombinant protein of human reticulon 4 (RTN4), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.